SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530780790|ref|YP_008432598.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780790|ref|YP_008432598.1|
Domain Number 1 Region: 15-45,188-384
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.98e-18
Family Bacterial dinuclear zinc exopeptidases 0.02
Further Details:      
 
Domain Number 2 Region: 64-187
Classification Level Classification E-value
Superfamily PA domain 0.0000000000916
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530780790|ref|YP_008432598.1|
Sequence length 542
Comment hypothetical protein N186_06230 [Thermofilum sp. 1910b]
Sequence
MKIREIAEKLFLELGQQDIVAGSREERESLEKIRGIFEELQLPVETYSFQCSSWREKRVS
LHLHDHELKAVAMPNSPSGSIEAKAVYIGERILREEFRGLDLSGKIAVVKMYRKIDEISW
QYLRAVERGAEAVIFVDPYPDRRRRIVIVPSVDYTFSVGSPPPVPVASVSLEDGLKLVQA
ANRGEKIILEIETDADNSATTGVVVAGDLEGPIFTAHIDKWLSGFTDNVLGLGIVLALAE
KYRENAGLIVFGSEEYGAPGYSPWYWIWGSRSFVSRLDERDRLSELGLIINFDTLGGQNI
SLSASGVDLLSGLRKMLGDSYRYTPDQVIFDSFSFTMHGHPALTIHTFEDTLPIYHTDKD
VPGNVDWQKIEEAVQLAEIIATHYMKNKWKMLDYTVLIDKVKEKAMKLKDIKEASELIDF
LEKIKIENEKQAHYIRRELTRPIYAGTYGEVFEDPVVSYPYLLEAVEDLLSLTQSQMDNT
KGESKLKALVKTVPGWETKIYDLRILVDKNAWEELRYLTRQLATVYLAETRKVFEKVASV
AL
Download sequence
Identical sequences S5Z8C8
gi|530780790|ref|YP_008432598.1| WP_020962892.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]