SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530781002|ref|YP_008432810.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530781002|ref|YP_008432810.1|
Domain Number 1 Region: 210-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.61e-70
Family Leukotriene A4 hydrolase catalytic domain 0.00039
Further Details:      
 
Domain Number 2 Region: 23-203
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.09e-34
Family Leukotriene A4 hydrolase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 566-790
Classification Level Classification E-value
Superfamily ARM repeat 4.68e-20
Family PBS lyase HEAT-like repeat 0.031
Further Details:      
 
Weak hits

Sequence:  gi|530781002|ref|YP_008432810.1|
Domain Number - Region: 792-822
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0275
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530781002|ref|YP_008432810.1|
Sequence length 823
Comment hypothetical protein N186_07295 [Thermofilum sp. 1910b]
Sequence
MVSVKTGRGFAYPEYEPFYPPEPPYELLRVKAEIDVDLASRSIEGKALNVLKCTGACEKI
VFHAVDMKIEEVRINGKQASYTYTGKELEIYPEKATSGDILEVQISYKTVEPRAGVWFIP
TDKGKPYLAYTQGQPEDTRFWLPTYDFPNRKTVVELVIRAPKGLKALSNGKLIEHAIGGE
KEKWVYRLDSKIPTYLIAFAVGDFYVKEDEYNGVLLQYAVPKGREADIERSFSQTKDMIR
LFEEYTGVKYPYPKYSQVCVDDFVAGGMENASITILTSATLHDEKAHIDFRSEPLVSHEL
AHQWFGDLVTCKDWSHLWLNEGFATLMEAIWRRHELGKDEFVYDLIGMMDSYLAEYGRYA
RPIVTRVYKYPDEMFDSHSYPKAALVLWSLASIIGEENFRKGIKRYLEAKREQNAETEEF
RRFMEEASGLKLDWFFEQYVYNAGHPSLKVSYKWDDKQKMLELKITQTQGEDSLPKYRLP
LELVILGQDYKEERKFLIDEKQYTLNLQLPSKPKAVCIDPEFKILKALSLDLPPEELLAI
IGSCPYLYPRVIAARELSKKASPVHIDELAKILLAEEEFWGLRSEVAQTIGSIGGQKARD
ALLNALSHVKHPRVRRAIVRALANFKEKPVADTLSKILLDENESYYVRAEAAASLGKIGL
KEYVDILARALETKSHNHVIAATSLDSIALLLGDEALATVEKYLSPDTPMPLRRAAIASL
GYMTPTQRVISLLEEASRSRHPHVKLAVVSACTRILSPKVMPILEKLQQDVSGRVARNAR
DALEQVRKHVEKGEEYRKLREEIDKLKEEERRLSERIERLEKK
Download sequence
Identical sequences S6A5W7
gi|530781002|ref|YP_008432810.1| WP_020963104.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]