SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530781064|ref|YP_008432872.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530781064|ref|YP_008432872.1|
Domain Number 1 Region: 134-265
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000000000000225
Family MJ1460-like 0.04
Further Details:      
 
Weak hits

Sequence:  gi|530781064|ref|YP_008432872.1|
Domain Number - Region: 24-102
Classification Level Classification E-value
Superfamily ACT-like 0.000435
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530781064|ref|YP_008432872.1|
Sequence length 276
Comment hypothetical protein N186_07605 [Thermofilum sp. 1910b]
Sequence
MGTENFEPYYMGRLVVVEGGNPFFFNVVLSREAVRALGIIEEVARVFREENVPILLFKAS
VPPSGVDGDVRIIVSADLKDEKQAERIAQKLRRIRYVSRVEYAKPIMPGVGVDAWSHPQM
LHSDRALVLSEIYLKEILAFGWGGIGPGFAGLMYRVFFEAGRKIYDELYEKLVRTREDFI
KLLEARARLLGWGVLEVVELTEDKAVFRVYDNIECMSLKGIEGAENALLRGLLAGILSGY
WKTDGYHIKPAETKCIARGDPYCQLEYRKEKYEPLV
Download sequence
Identical sequences S5ZX40
gi|530781064|ref|YP_008432872.1| WP_020963166.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]