SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530781207|ref|YP_008433015.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530781207|ref|YP_008433015.1|
Domain Number 1 Region: 228-608
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.8e-86
Family Amylase, catalytic domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 126-229
Classification Level Classification E-value
Superfamily E set domains 0.0000728
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Weak hits

Sequence:  gi|530781207|ref|YP_008433015.1|
Domain Number - Region: 24-81
Classification Level Classification E-value
Superfamily E set domains 0.0227
Family AMPK-beta glycogen binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530781207|ref|YP_008433015.1|
Sequence length 685
Comment hypothetical protein N186_08320 [Thermofilum sp. 1910b]
Sequence
MYKVIGREKLGDKRLGRYIVEFSCRWPQEASFLYLVSTFTSYFPGRIEMKREESRGKAIV
KLWEGVYPYRFASTCGASFLDEENTLKETLKPWPDSDYTAEFSLAMIGVEEFIKASREEK
APPELIIHDENDPAFISHYLGDTIIRLKAPRNTLRGAYIETSKGKVVQMEKFHSNKFVDY
FQGRVAGRVDAYRFLLRLEDGDAVYGKNGVGDEEYIYPVTIRGVDHAEWFLGATYYLIFP
DSFTREKKVIQGDRPRTRLGGKIKDITLSLDHIASLGVDAIYLTPIYKAQSYHRYDVIDH
FSLDDDIGTWEDWEELVRESEKRNIKVVVDVVAHHVSPCSNEFREAILNENSRYKGWFRF
NREPEPGELEALRKLVSGGCDKPSSDLLGKKPFYETFFCNWFMAKLNYSNPEVKERLVKL
AHFWLEKGARGFRIDVGHAIPDDAMQFFYEKVKEKCPSCPVILEITNGDSLYPLGITADS
AMNYDLRALLLDFFINKSIDAYSFVEGVKNLYVDMPLYAANSMYNLLGSHDTPRIATLAE
KCGEKCLKALYVAMFLLPGSPSIYYGDEFGMKGGHDPNNRMPITWNSNEWNIELLELIRK
LSELRKKFLSVKYGFFDAEPLNTEAVKITRWMDSEEVLLIINREGNIEVTLKEEYTELNS
DRRTRRIELDPYSWVILYKKKIKEK
Download sequence
Identical sequences S6A608
gi|530781207|ref|YP_008433015.1| WP_020963309.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]