SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530781459|ref|YP_008433268.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|530781459|ref|YP_008433268.1|
Domain Number - Region: 18-143
Classification Level Classification E-value
Superfamily Globin-like 0.0036
Family Globins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530781459|ref|YP_008433268.1|
Sequence length 190
Comment hypothetical protein N186_09595 [Thermofilum sp. 1910b]
Sequence
MSLREKILKNGLYSSLLLGINNQTKTTLHDMSHMVNLSKDEIVHACMYSLLQNSELARIF
RERGLEPGYVRGILENILDEMFKGDFSEEHTVRIARLTFDLIKIGIPPRMLIMLMFILSQ
EIVRHSHSNSNQVKAIIQACGWLLSNMMESYFTIDEEVFANSLGITSGSYDRLLKLTAEK
IYRNIDKELA
Download sequence
Identical sequences S5ZXW5
gi|530781459|ref|YP_008433268.1| WP_020963562.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]