SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330828140|ref|YP_004391092.1| from Aeromonas veronii B565

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330828140|ref|YP_004391092.1|
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.59e-95
Family Methylenetetrahydrofolate reductase 0.00000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330828140|ref|YP_004391092.1|
Sequence length 296
Comment methylenetetrahydrofolate reductase [Aeromonas veronii B565]
Sequence
MGFHSARQVEALNQSLADLNGDISVSFEFFPPNSEGMENTLWQSIERLKVLEPKFVSVTY
GANSGTRDRTHKVIKDIKERTGLIAAPHLTCIDASRDELRTIARDYWNSGIRHIVALRGD
LPQGLEKPDMYATDLVALLKSEADFDISVAAYPEGHPEAKSAQSDLLNLKRKIDAGANRA
ITQFFFDVETYLRFRDRCAAIGIDAEIVPGILPVSNYQTLAKFAGFTNVKIPRWMHQRFE
GLDNDQMTRNLVGASIAIDQVRVLSQEGVKDFHFYTLNRSELTYAICHTLGVRPKG
Download sequence
Identical sequences A0A0E2LB77 A0A0T6P5R9 A0A1E4VAF4 A0A1E4WWF2 K1JC26
gi|330828140|ref|YP_004391092.1| WP_005340191.1.11464 WP_005340191.1.12376 WP_005340191.1.12379 WP_005340191.1.16309 WP_005340191.1.18697 WP_005340191.1.19238 WP_005340191.1.20345 WP_005340191.1.21327 WP_005340191.1.26577 WP_005340191.1.2836 WP_005340191.1.31752 WP_005340191.1.32015 WP_005340191.1.33469 WP_005340191.1.36635 WP_005340191.1.40643 WP_005340191.1.45813 WP_005340191.1.46646 WP_005340191.1.4897 WP_005340191.1.50500 WP_005340191.1.53126 WP_005340191.1.57093 WP_005340191.1.59211 WP_005340191.1.62883 WP_005340191.1.64938 WP_005340191.1.6530 WP_005340191.1.65517 WP_005340191.1.68908 WP_005340191.1.70826 WP_005340191.1.78161 WP_005340191.1.86252 WP_005340191.1.90218 WP_005340191.1.90607 WP_005340191.1.91975 WP_005340191.1.92808 WP_005340191.1.96069 WP_005340191.1.98657 WP_005340191.1.99268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]