SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330828455|ref|YP_004391407.1| from Aeromonas veronii B565

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330828455|ref|YP_004391407.1|
Domain Number 1 Region: 549-1038
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-133
Family ALDH-like 0.000000404
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000365
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.12e-62
Family N-terminal domain of bifunctional PutA protein 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330828455|ref|YP_004391407.1|
Sequence length 1054
Comment Delta-1-pyrroline-5-carboxylate dehydrogenase/L-proline dehydrogenase [Aeromonas veronii B565]
Sequence
MFKATQVLAADYIPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLEQVTQRARTL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANLLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSRELGYTHTYDMLGESALTMQDADKYLTDYRNAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMCERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSDANRGWGKLGMVVQAYSKRALPVLCWLTALAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFIAPQFATHNANT
VVSILEMVGDRQFEFQRLHGMGEELHNAVLNDNPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYSGFANDRIPQPVNLFTDRKNSSGVNMNI
LSIQRPFFARLKELESKQWLAGPIVDGETLKRSEARTVLSPQDVSLTVGKIHWADEQAVE
QALASAHAAFPRWRETPVSERAAALEKLADLLEANREQFVSLCTREAGKLLQDGIDEVRE
AVDFCRYYAVQARSLMGQATLLPGYTGEQNELFLQGRGVFVCISPWNFPLAIFLGQIAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADPRIGGVC
FTGSTEIAKLINMTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAERVLEILTGAMQELKVGNPAEHNTDVGPVIDADAKAGLDAHLARM
IPRARLIAQAPMPAATMEGHFVQPTALEIGSIRELAKEQFGPILHVVRYATRDLDKVISD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLGRFVTEKTRTINTTAVGGNASLLAMGDA
Download sequence
Identical sequences WP_005354445.1.12379 WP_005354445.1.36635 WP_005354445.1.64938 WP_005354445.1.99268 gi|330828455|ref|YP_004391407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]