SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330829050|ref|YP_004392002.1| from Aeromonas veronii B565

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330829050|ref|YP_004392002.1|
Domain Number 1 Region: 447-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330829050|ref|YP_004392002.1|
Sequence length 607
Comment sulfate permease family protein [Aeromonas veronii B565]
Sequence
MRDFFSLERWLPGLAALLHYQRAWLMPDLRAGLSVAAVALPVAIAYAELAGVGAIVGLYS
CILPMLIYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDPTRHWQLVMTMTAMTGFWCL
IASRFKLGVLADFLSRPILMGLLNGVAITIMVGQLSKIFGFTFSERYLIERIASGATYIT
QTHLPTLAMSLVALLTLLLAKRYKPAWPSSMVAMVVTAALVWGFNLGQFDIATLGTVGSG
LPAFQMPEFPPGLMRELVLPALNLAMVSFVSMMLTARSFAAKNGYEIDADKEFRALGMAN
LASAVSQGFAISGADSRTAVNDANGGKSQLVSIIAAAVIALITFYLTAPLKYIPTAALGV
VLVMASLSLTDFRGLWALRHSDRAAFWLALVTFISVLTMGVIPGITLAVLLGLFQFLRNV
MRPTDQLLGMDDEGVVRTLGDNEQAKAIPGILVYRFNSPLTYFNAPYFKRRVLALLVQDP
RAPKCLVIDAVACFTHQDISVMSMVGELHKELKRRGIHMVMAGRHGQMTHWLKQAGVRVG
DEGIILCPDMYQALRLTRCYREPVFKDDAVVESTTDAIRSNWPQDDALPDSARLTLPSEQ
EAGATPA
Download sequence
Identical sequences gi|330829050|ref|YP_004392002.1| WP_005353210.1.12379 WP_005353210.1.36635 WP_005353210.1.64938 WP_005353210.1.99268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]