SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378972547|ref|YP_005221151.1| from Treponema pallidum subsp. pertenue str. SamoaD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378972547|ref|YP_005221151.1|
Domain Number 1 Region: 196-355
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.57e-47
Family Peptidoglycan hydrolase LytM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378972547|ref|YP_005221151.1|
Sequence length 363
Comment M23B subfamily peptidase [Treponema pallidum subsp. pertenue str. SamoaD]
Sequence
MARIRRYKRIEYAFVRFCIDRCTRCARLVREAAARLGAAGRAELTVMLVPHSQCAARTFC
TTARTLLCVLLCGVGVLASFFWFAHQSVTSARRLAAVRAEVDRTQVHLALLRQEAAELIR
TSKAFQTSLSQTFSQVGLSGLQSGAEKPVRSVSDTNQSNEPDDASAKDGAQKGNVGVTEQ
HGKNAQGVGSEPEELRRIAAYFQNSVQPVREIGKLLNSQTALFSDIPSLWPIKGGVGHIS
MAFGKNRHPFTGQWYVHKGIDLSTHRSGDPIVATADGHVVTVEYDSGWGNYVIIKHKHGF
YTRYAHMQSYTVTRGQHIRQGQIIGYIGATGVATGPHLHYEIHIGSDVVDPGKYLNVKTA
GAG
Download sequence
Identical sequences A0A0A7X1X2 H6KU93
WP_014342245.1.101681 WP_014342245.1.10609 WP_014342245.1.11013 WP_014342245.1.13630 WP_014342245.1.177 WP_014342245.1.22706 WP_014342245.1.24110 WP_014342245.1.24144 WP_014342245.1.26337 WP_014342245.1.26670 WP_014342245.1.28216 WP_014342245.1.31174 WP_014342245.1.34567 WP_014342245.1.35526 WP_014342245.1.35589 WP_014342245.1.37724 WP_014342245.1.38137 WP_014342245.1.38252 WP_014342245.1.38852 WP_014342245.1.39803 WP_014342245.1.41302 WP_014342245.1.42739 WP_014342245.1.42752 WP_014342245.1.43796 WP_014342245.1.44774 WP_014342245.1.45335 WP_014342245.1.49513 WP_014342245.1.50901 WP_014342245.1.51333 WP_014342245.1.61389 WP_014342245.1.63356 WP_014342245.1.72815 WP_014342245.1.73546 WP_014342245.1.74079 WP_014342245.1.78381 WP_014342245.1.79283 WP_014342245.1.82112 WP_014342245.1.89996 WP_014342245.1.90600 WP_014342245.1.90779 WP_014342245.1.92130 WP_014342245.1.96085 WP_014342245.1.98226 WP_014342245.1.98956 WP_014342245.1.99137 WP_014342245.1.99367 gi|378981522|ref|YP_005229827.1| gi|378972547|ref|YP_005221151.1| gi|378973613|ref|YP_005222219.1| gi|378974677|ref|YP_005223285.1| gi|488657461|ref|YP_007935843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]