SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325102990|ref|YP_004272644.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325102990|ref|YP_004272644.1|
Domain Number 1 Region: 124-276
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.23e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 400-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.75e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 258-281,311-413
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.65e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325102990|ref|YP_004272644.1|
Sequence length 699
Comment nitrite and sulfite reductase 4Fe-4S region [Pedobacter saltans DSM 12145]
Sequence
MQSFRSELENPLVAKEIIDLEKKIRAFREGKIHDEKFRSLRLARGIYGQRQPGVQMVRIK
IPFGKITFKQILKIADVSDEYASKNLHFTTRQDIQIHYVSLDRTPELWAKLAEDDITIRE
ACSNTVRNVTASCTAGIDPAEPFDVSAYAHGFFKYFLGNPVSMELGRKFKFGFSSSEEDT
AFSFIHDIGFIPKVKYENGEEIRGFKVLLGGSLGAQPYIGQLVTDFMHEDLIIPFSEAVL
RVFDRYGERTNRNKARLKFLLNKVGFEEFLKMVEEERVSTKVKTYKIDTSVIDTPNIPEP
VEITVEIPAYKQLAYEMWSATNVFQQKQEGFYGVFVKVKTGDMSTEKVRKFVEAVRPLIA
DEMRVTINQGLLLKYVRKEALPALYLILDELGLSEPGHNSVADVTTCPGTDTCNLGISNS
MELSRVLEALVHEEYEDFVYNKEIKIKISGCMNSCGQHGIAHIGFHGSSMKVNGKIMPTV
QVLLGGGAVGNGEGRAADKIIKVPSKRAPQVLRTILDDYRIKGESFGSFLNYYDGLGKDY
FYQLLKPIADQETVTDEDFIDWGQNEDFVRAIGVGECAGVVIDLVATLIFETEEKYGWAL
EAYDQQLWSDAIYHAYNTLVSGAKAVLLDKGISQSTQIGIIKAFDEHSAAEFDVDGFENL
VLQINKYEPSQEFAEAYLAQARDFLEKVKSFRGRTEQVG
Download sequence
Identical sequences F0SEF7
gi|325102990|ref|YP_004272644.1| WP_013631325.1.90845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]