SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325106024|ref|YP_004275678.1| from Pedobacter saltans DSM 12145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325106024|ref|YP_004275678.1|
Domain Number 1 Region: 28-244,291-328
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.2e-69
Family Type II chitinase 0.0000199
Further Details:      
 
Domain Number 2 Region: 252-290
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000147
Family Chitinase insertion domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325106024|ref|YP_004275678.1|
Sequence length 334
Comment chitinase [Pedobacter saltans DSM 12145]
Sequence
MKEKLLNLSFVLLAFFSFKSVESKEKPKVIVAYVTSWSSVKPDPFLMTHINYAFGHVSQD
FKGVRVSNESRLREVVTLRTKNPKLKVLLSIGGWGSGNFSEMAASDTLRKSFAKDCSAKV
KEFDLDGIDIDWEYPTSNAAGISASPADYYNFTLLMRDIREEIGKKKLLTLATAASAEFI
DFKGINPYIDFVNVMTYDMATPPFHHAGLYRSEFTKGLSVEEAILKHFNAGVPYDKLVMG
IPFYGRGNKEIGGFTNYRNILELKGYERKWDEVSKVPYLVDSAGNFVCTYEDSESIAYKT
EFIKKMGLLGGMYWDYAGDTNDAVLAKKVKKGLL
Download sequence
Identical sequences F0SCL2
WP_013634339.1.90845 gi|325106024|ref|YP_004275678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]