SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for JGI_V11_147625 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_147625
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily ITPase-like 4.45e-49
Family ITPase (Ham1) 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_147625
Sequence length 166
Comment pep:novel supercontig:GCA_000320545.1:scaffold_248:1610:3231:1 gene:aug1.248_g22333 transcript:JGI_V11_147625 description:""
Sequence
MDKTLTFVTGNKHKLAEVQAILKGVVDCTNKKLDLPEMQGEPVEVSQEKCKLAVEEIKGP
TIVEDTSLCFNALGGLPGVYIKWFLKKLGHDGLNKMLSAYEDKCIFCYCEGPGKEIVEFV
GRCPGKIVPARGPTDFGWDPVFEPDESKGETFAEMDKQEKNKISHR
Download sequence
Identical sequences JGI_V11_147625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]