SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_45716 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_45716
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily Hsp33 domain 1.83e-47
Family Hsp33 domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_45716
Sequence length 276
Comment pep:novel supercontig:GCA_000320545.1:scaffold_145:36810:40344:1 gene:e_gw1.145.2.1 transcript:JGI_V11_45716 description:""
Sequence
MSDNAEVSCLVADATELVQEAQTRHNLSLTATVALGRSLVGGLLLAAFKAEGDAVQLKFS
GRGPLGDIMVIADQKGMVKGRISNPQFEVPPRADGAPDVGSAVGKGALEVVRSNTNPYMP
FYKPYTGVVPISTGEIAEDIAFYLASSEQTSSAIGLGVVLNPDGTVKKAGGWHLQVLPLA
SEGTLVMLETNIQNLGSTTDLLSEGVSTLGISRLLLDGLADVEDATFSLVPKYGPCEESD
LESRMVRAIAALGREEAESLLEENDGQYLLMNEVCS
Download sequence
Identical sequences JGI_V11_45716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]