SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_86837 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_86837
Domain Number 1 Region: 286-327
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000863
Family Zn2/Cys6 DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  JGI_V11_86837
Domain Number - Region: 215-248
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0902
Family HPr kinase/phoshatase HprK N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_86837
Sequence length 419
Comment pep:novel supercontig:GCA_000320545.1:scaffold_14:517839:519439:1 gene:estExt_fgenesh1_pg.C_140113 transcript:JGI_V11_86837 description:""
Sequence
MDTRMGPQMAAPMDTRGTSAASKLMQFSRDMQARTIPTAQAMVAQPRNGMVLNSQCHQRN
HMPSASSAHGRANWRASPQTFASNSRPQISPYTNPFFGGFEFKSNQPCPASFQRLRRKPV
LDDSMGQELKSDYYGYQNTKLLREHDGSFSHASIPQLHQQMNGFYQGRSHMKRRRLMSEE
NMMPYSVTEREQQRQFFDPDMLMRREIMQWTEDQMSYHASRRAQIYGNHEMGQLITNPNH
ERLQRMKEGQMPYDASFASQRSSLRAPQGYIMVPVPSRKGVKGSKQPRRLPNGMACLSCR
LRKVRCSGTRPCLQCLCRSEACQDAPKKVGQKKSSEKKSEGTTNLRHPEQQSSVASISSS
SASLSNAVNGRVKSQVSSSGSPSSISGNGLSSQMRNGQNMSTKNEELSIEETRNLKRKL
Download sequence
Identical sequences JGI_V11_86837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]