SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_37325 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_37325
Domain Number 1 Region: 54-386
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.42e-82
Family IF2B-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_37325
Sequence length 389
Comment pep:novel supercontig:GCA_000320545.1:scaffold_19:909068:910237:-1 gene:e_gw1.19.20.1 transcript:JGI_V11_37325 description:""
Sequence
MQYDDPKRMVKFNKLRVLDRTSVQKQKRVPIFSHLPQYEGHHAVSLQVGLDKEEIHPAIL
RLGVKFAEGVIVGSNARCMAMLTALKDAVRDFEGNEGKEMKRDLMDMLKPIIRFVAVDCR
VMSLGMGNAIRYIKTAINNLENGVSLTQGKESILEKIDEFIYERIEIADQVIAREGAKRI
QDGDVIMTYARSKVVENVITKAKEENRKFRVVIVDSRPKFEGKALGKRLVDKGIDCTYIL
LNGLSYVMKEVTKVMIGASAILANGAVLSRVGTAVVGMMADVYNIPVIVCCETYKFHERV
QVSSISFNELGDPEDLVKIDKDTRGKVNNVTEDKNSLADWRKIKNLKLLNLTYDLTPARF
VSMVVTEVGQIPVTSVPAVLREYMKYSTT
Download sequence
Identical sequences JGI_V11_37325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]