SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_75244 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_75244
Domain Number 1 Region: 75-184
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.92e-24
Family Calcium ATPase, transduction domain A 0.00064
Further Details:      
 
Domain Number 2 Region: 247-379
Classification Level Classification E-value
Superfamily HAD-like 0.0000000000000054
Family Meta-cation ATPase, catalytic domain P 0.014
Further Details:      
 
Domain Number 3 Region: 10-66
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000471
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_75244
Sequence length 391
Comment pep:novel supercontig:GCA_000320545.1:scaffold_33:533047:535291:1 gene:fgenesh1_pg.33__105 transcript:JGI_V11_75244 description:""
Sequence
MESKATAERVYQTPLRELLEEYRVNVKEGLSTEEARKRLERDGRNELLPKKSFLQKWFPW
FFRDPLAEGFRNLMPRMVIVIRGGNEMKVDARELVEGDLVKGSSGQLIPADIRLIECNDL
KADQSAFTGEPEPLKKTSGESRCDTYLDSENLLFSETYVTSGAYTGFVIATGKRTVIGTL
ASLVSNNKTHPGVTRADKKKAVNLMENKQVLCKSFECLNTIRFGKSNNSLALVVKAKYLF
KKDGGLEAGIKDLVDRCRDSNISLIITSETDVDDLTNSGKKANIIRNDDKVVDVGVIIKA
VEEKKSSEVVVNLVGVARCQGCQTLPLVTVLQQAAKTVVYIGESINDTPALAKSHCGIAT
EDSTDIAKGAADAVLFDGENVLAGLTALLFD
Download sequence
Identical sequences JGI_V11_75244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]