SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_87410 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_87410
Domain Number 1 Region: 141-268
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 7.5e-36
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 37-139
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.52e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_87410
Sequence length 273
Comment pep:novel supercontig:GCA_000320545.1:scaffold_20:270127:271540:-1 gene:estExt_fgenesh1_pg.C_200044 transcript:JGI_V11_87410 description:""
Sequence
MMASLLSTTFSKRLVGGMRAVARNGAPRPSFYRRAMSTKTFEIYRWNPDEGGEPKMQSYD
LDLKECGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGGNNLACLSKIEDNGK
PTKIYPLPHMEVIKDLVPDLNNFYQQYKSIKPWLQPAESSPKAQDGEYLQTKEDRKLLDG
MYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIADSRDGDTQARLENLDDSFKLYR
CKTIFNCTNTCPKGLNPGRAVQQIKKAIHDGEH
Download sequence
Identical sequences JGI_V11_87410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]