SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for JGI_V11_88832 from Bigelowiella natans CCMP2755 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  JGI_V11_88832
Domain Number 1 Region: 213-435
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.2e-52
Family NagB-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) JGI_V11_88832
Sequence length 809
Comment pep:novel supercontig:GCA_000320545.1:scaffold_39:85694:92336:-1 gene:estExt_fgenesh1_pg.C_390017 transcript:JGI_V11_88832 description:""
Sequence
MPETEQGMKLAWMPIDGAVAMLMTRHQVTNPGPKTVSDVARSLTGEQKVFQGHVFVRFAQ
GAPALMLLQCEESGSVVTPPQGSTTGLEFEGHTTGIVPFIEIATWKSAPMSELPKDTEEI
AFCSPGHAPNEHRERQATFHQWVICISPYVVCKSLSKFVMRESVMFNVVERKQERRKREQ
KRDKENSCIAPSIDLHLGCTESRTTTKPLVSVGNDKKAVGDIAAKFIIEEAKKAIASTGR
FTVAFSGGSLPKIVGPALVEKKVEDTDKWFVFFSDERCVKLSSDDSNYKSVREFVLDPLK
IPKKNVVTIDPNQYEDAEKAAKLYEESVAGFFKDSSSSTPVFDLILLGMGPDGHTCSLFP
KHKLLAETKANIAPITDSPKPPSNRITFTYPVLDAAKAVAFVCCGGGKSGALKTVIEGSE
TPDDQLPSGRIKNKRRNTDQTYYITIDPEICCCRVKRRIYAIQNLVVKQATHNSLSFSTP
QSPRFFRWGALGLSGGGLKRKANGGQIISAGRAYVVDNFCEARRQWRRRQLQVIHDSGYE
DVEVYPLPTRLRDGDERVCARVQIVTGTCKQPEKEISGLVKIVHKDEAIGKVKVTNRRKR
KPTDAFDPLIPGSDLVYHRVVADIVLKNDTEDGEVKYKIELSRKWEGAALRLRMLERIMN
KYPTTSIVISLNNTQVQIWQLLRLAALSANRDISVGHITGINSEWTPIDLKVNSSLSFPR
PQGVFLPKNCEYSLTVRMAPEASHTYKRMRRLLTPFRDPPGKIFSIGKSGQHQQRSDQAG
TGDLENKSEATSSSRRRRRAKRERLKNRT
Download sequence
Identical sequences JGI_V11_88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]