SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345301807|ref|YP_004831001.1| from Rhodothermus marinus SG0.5JP17-172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345301807|ref|YP_004831001.1|
Domain Number 1 Region: 37-341
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.19e-58
Family ADP-ribosylglycohydrolase 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345301807|ref|YP_004831001.1|
Sequence length 364
Comment ADP-ribosylation/Crystallin J1 [Rhodothermus marinus SG0.5JP17-172]
Sequence
MEHNNLLLEWLFEEQRIRLNRGPIFDLDPGPVDAMARDRVEGMLLGLAIGDALGYTTEAM
RPGERRRVFGEIRDYRPGVRGEGRTGLPSDDTQLAFWTLEQLLEDGHLVPEHVARRFLNN
RAHIRGIGRTVRAFLDRLEMGYPWYEAAPHSAGNGALMRIAPIILPHLRTGTRALWWDAA
LLAMLTHNDAASTAGCLAFVFIWWQLLQGIRPDHPDWWIETYVSVARHLETSNYRPRGGE
YLDFEGPVWQFVARHVPEAYYQDMSVREACDRWYSGAFLLETVPSVLYILMRHADDPEEA
IVRAVNDTYDNDTIAAIVGATVGAMHGAQALPERWRRGLPGELYGDDPGRVQRLITQAME
QFGP
Download sequence
Identical sequences G2SLH3
gi|345301807|ref|YP_004831001.1| WP_014072503.1.101848 WP_014072503.1.92079 gi|345301807|ref|YP_004831001.1|NC_015970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]