SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322831015|ref|YP_004211042.1| from Rahnella sp. Y9602

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322831015|ref|YP_004211042.1|
Domain Number 1 Region: 18-400
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.19e-130
Family GABA-aminotransferase-like 0.000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322831015|ref|YP_004211042.1|
Sequence length 405
Comment succinylornithine transaminase family [Rahnella sp. Y9602]
Sequence
MAEKSSVDRGTFDKVILPVYSPAKFIPVKGKGSRVWDQQGNEYVDFAGGIAVTALGHCHP
ALVKALHEQGETLWHVSNVFTNEPALRLAQKLIDATFADRVFFANSGAEANEAAFKLARY
YASHRHSPYKSKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLDAVKA
VIDDHTCAIVVEPVQGEGGVTPATKAFLQGLRELCDKHQALLVLDEVQSGMGRSGKLFSY
MHYGVTPDILTTAKALGGGFPVSAMLATEDVASVMEPGKHGTTYGGNPLACAVAEAALDI
INTPDVLAGINERREKFISALEAINQKYHIFSEFRGQGLLIGAELSDAYKNRAGEFHAAA
AEFGLMMLVAGPNVMRFAPSLVIDFADIEEGMERFEKAVGKVCGG
Download sequence
Identical sequences A0A0H3F429
gi|322831015|ref|YP_004211042.1| WP_013573632.1.59798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]