SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322832229|ref|YP_004212256.1| from Rahnella sp. Y9602

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322832229|ref|YP_004212256.1|
Domain Number 1 Region: 1-359
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.31e-117
Family GABA-aminotransferase-like 0.000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322832229|ref|YP_004212256.1|
Sequence length 361
Comment phosphoserine aminotransferase [Rahnella sp. Y9602]
Sequence
MTQVYNFSAGPAMIPAEVLRRAEQELCNWHGLGTSVMEISHRSKEFIQVAEESEKDIRDL
LNIPSNYKVLFCHGGARAQFAAVPMNLLGEKSSADYIDGGYWAHSAVKEAQKYCTPNVID
VTTTIDGKRGILPMSEWKLSADSAYVHYCPNETIDGIAIDEMPDFGDKIVVADYSSCILS
RPIDVSRFGVIYAGAQKNIGPAGLTLVIVRDDLLGKARTELPSILDYTVLAENDSMFNTP
PTFAWYLSGMVFKWLKEQGGLREMEKRNRAKAELLYGAIDRTGFYRNPVAAVNRSWMNVP
FQMADASLDKRFLDQAQEAGLHALKGHRVAGGMRASIYNAMPIEGVKALTDFMAEFEKRH
G
Download sequence
Identical sequences A0A0H3F896 H8NT17
gi|384257332|ref|YP_005401266.1| gi|322832229|ref|YP_004212256.1| WP_013574831.1.59798 WP_013574831.1.91760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]