SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322833498|ref|YP_004213525.1| from Rahnella sp. Y9602

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322833498|ref|YP_004213525.1|
Domain Number 1 Region: 4-402
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.41e-125
Family Cystathionine synthase-like 0.000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322833498|ref|YP_004213525.1|
Sequence length 406
Comment SufS subfamily cysteine desulfurase [Rahnella sp. Y9602]
Sequence
MSFPLERVRSDFPVLSREVNGQPLAYLDSAASAQKPHQVIQREMSFFEQGYAAVHRGIHT
MSAEATEQMENVRTQAAHFMNAASAEEIVFVKGSTEAINLVANTWGREFLHAGDHIILTE
MEHHANIVPWQMLAKERDLHIDVWHLTPEGELDLSQLESLITPRTKLLTLAHVSNVLGTV
NPIEKIIPQAKAAGLTVLVDGAQAVMHHAVDVQALGCDFYVWSGHKLYGPTGIGILYGRK
ALLDQMPPWEGGGSMIKHVSLTEGTTFAAAPWRFEAGTPNTGGIMGLGAAMEYVTELGLE
NIHAYEQELMNYALNAMAQVPDIQIYGPATRAGVIAFNLGKHHAYDVGSFLDQYGIAIRT
GHHCAMPLMSFYGVPAMCRASLAMYNTREEVDRLVAGLQRIHRLLG
Download sequence
Identical sequences A0A0H3FBG7 H8NWW0
gi|322833498|ref|YP_004213525.1| WP_013576097.1.59798 WP_013576097.1.73690 WP_013576097.1.91760 gi|384258633|ref|YP_005402567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]