SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322833794|ref|YP_004213821.1| from Rahnella sp. Y9602

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322833794|ref|YP_004213821.1|
Domain Number 1 Region: 13-383
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.34e-97
Family AAT-like 0.0000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322833794|ref|YP_004213821.1|
Sequence length 384
Comment class I and II aminotransferase [Rahnella sp. Y9602]
Sequence
MKSAMSPLSKLPDVGTTIFTVIGQLSAEHNALNLSQGAPNFSCQPALIDSVAKAMREGHN
QYAPMSGVAALRHALSAKVEALYGCKYDADSEVTVIASASEGLYSAISALVHPGDEVIYF
EPSFDSYAPIVRLQGAKPVAIGLSLDDFSIDWDQVASAINSRTRMIIINSPHNPTGAIFT
EFDIERLTALTQNTDIVILSDEVYEHVVFDGERHESMACYPQLAERSVIVSSFGKTYHVT
GWRVGYCLAPAELMDEIRKVHQFMVFSADTPMQVAFAEALADPQSYLGLADFYQQKRDLL
AEALSESRFELLPSRGSFFMLARFSHFSPLTDDEFVLSLIRDHQIATIPLSAFYSNNQPT
GLIRLSFAKDNDTLYEGARRLCRV
Download sequence
Identical sequences A0A0H3FCE9 H8NXE1
WP_013576390.1.59798 WP_013576390.1.91760 gi|384258972|ref|YP_005402906.1| gi|322833794|ref|YP_004213821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]