SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322834876|ref|YP_004214903.1| from Rahnella sp. Y9602

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322834876|ref|YP_004214903.1|
Domain Number 1 Region: 4-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.06e-102
Family AAT-like 0.000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|322834876|ref|YP_004214903.1|
Sequence length 395
Comment GntR family transcriptional regulator [Rahnella sp. Y9602]
Sequence
MNTEGLLAARMVRLKSSAIRELLKHSKMEGVISLAGGIPSSALFDFDGLREATQLAITEQ
PEHAFQYGLTEGSYTLRERIAELCQERGVVAQPEDIVVTAGSQQALDLVMRAVVNPDDVF
VVERPTYLAALQTLELAEAKLLSVGSDGDGMIVDELAERLKTQKIKGVYLVPTFGNPSGV
TLSRARREQLVKLAAQHEFLIVEDDPYGELRFTDERQPTLFELSKAMFGHADNIIYTSTF
SKILAPGLRLGWVIMPDWLLHKVAIIKQAADLHASALSQTIAEYYLGLGRLPKQIETIRA
AYKNKCQIMAGLLERELGDVLTFEYPKGGMFLWARFREPRNCADWMKKTLEQGVVFVPGE
FFYADNPDHSTFRLSFATATEEQMHEAVARLKRAL
Download sequence
Identical sequences A0A0H3FHQ3 H8NUB8
gi|384260097|ref|YP_005404031.1| gi|322834876|ref|YP_004214903.1| WP_013577463.1.59798 WP_013577463.1.91760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]