SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320352817|ref|YP_004194156.1| from Desulfobulbus propionicus DSM 2032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320352817|ref|YP_004194156.1|
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.46e-24
Family Penicillin binding protein dimerisation domain 0.0042
Further Details:      
 
Domain Number 2 Region: 173-394
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.25e-17
Family beta-Lactamase/D-ala carboxypeptidase 0.0096
Further Details:      
 
Domain Number 3 Region: 550-603
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320352817|ref|YP_004194156.1|
Sequence length 605
Comment Penicillin-binding protein dimerization domain-containing protein [Desulfobulbus propionicus DSM 2032]
Sequence
MAKTLRSKKKRRWLIPFFVILLTAAGIVLYRYPPSLQDIGRIIQSAVGKISSLSAGQTPA
EPVLRGTVYDRKFRELAVSYRLFSLIVNPVEVVDRRKAAEALAPLVGDKVENIELRLKTA
QYSMVLSDDLDARQAEQIAALQLRGVTCKATEARFYPGHTAASHVLGFMGDGVGLAGVEG
KYDTVLQAGGFRKSNIPDIDFQGEESLGQKETDIVLTLDIDLQRQLENRFREHLAAQGSE
KGMGLLIDPSSGRILALVNQPSFNPNYFWKANESNRINRIYNHVLDKELIRPLLARAAAI
EREGLDGPGILPATVAAPDYGFTPEQLDAFEQQIQLYGSVFGNWESGPAAQERTGAQPVV
TGVQVGVTLASLVNGGWRITPYVVDSIYDHATMKRYSRSNEATEKIHVLDPALGVKIRRE
LFANWLLEQENLVVFTADHVQIQPDKDQYSRYSMQDLFVGLAPAKQPKFLLLMAVEQDHL
LPVAQRKDNENGVLELMGKELLAALAKVPPPDALPEKPPEKSEENLRQFFISKRLNFRNA
PGKANEPIPRMPQLRGMSLRKGLQQIDKYKMTVRVNGSGRIIAQYPLPGQPLTGVDECIL
TLDSK
Download sequence
Identical sequences E8RD66
WP_015723410.1.51671 gi|320352817|ref|YP_004194156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]