SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320352201|ref|YP_004193540.1| from Desulfobulbus propionicus DSM 2032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320352201|ref|YP_004193540.1|
Domain Number 1 Region: 208-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.57e-63
Family PFOR Pyr module 0.026
Further Details:      
 
Domain Number 2 Region: 12-228
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 3 Region: 497-601
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000597
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320352201|ref|YP_004193540.1|
Sequence length 618
Comment pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Desulfobulbus propionicus DSM 2032]
Sequence
MKQLQAVNDFVIRFANVNGSGSASANNLFAKAVFRMGVPVSPKNIFPSNIQGLPTWYEVR
VNEQGRVGRRGDIDMVVAVNGQTLRQDYDSLVPGGYFLYDSSKALPEDFQRDDITIIGIP
LTLLCNEAFDNPKMRPLLKNIIYVGALASLLDMELQVLIDSLIKQFRKNPKLAEPNIQAL
RLGHDYAGEHFAGVCQLSVRRSDRVGDSIIMDGNSAVALGAIYAGATVVGWYPITPSTSI
IEAFGRYAEQFRIEQDTGRIKAAIVQAEDELAAIGIVIGASWNGARAFTATSGPGISLMS
EFLGLAYFGEIPVVLIDVQRTGPSTGMPTRTQQSDVLACAYASHGDTRHPLLFPCDPREC
FDMTADAFDLAERLQTPVLVMSDLDLGMNDHFGPPLAWDPARRYDRGKVLDAAQLEALTT
RWGRYKDVDGDGICSRTYPGTHPDKGVYFTRGTSRDEYSAYTEDSGAYVRNMERLLLKWE
TAKRLLPLARIKIASPQARLGAVFYGSTTPSAYEAIDLLHQRGIVLNTMRLRAFPFQQEV
IDFIHNHELVFVIEQNRDGQMRTLLINEGNLPPHKLIPIASYDGLPVASRFLVRALEEAL
AERGISLQQLASGQGGGQ
Download sequence
Identical sequences E8RHC3
gi|320352201|ref|YP_004193540.1| WP_015722797.1.51671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]