SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320352497|ref|YP_004193836.1| from Desulfobulbus propionicus DSM 2032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320352497|ref|YP_004193836.1|
Domain Number 1 Region: 169-388
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.24e-54
Family ATP sulfurylase catalytic domain 0.00000631
Further Details:      
 
Domain Number 2 Region: 14-168
Classification Level Classification E-value
Superfamily PUA domain-like 2.58e-43
Family ATP sulfurylase N-terminal domain 0.0000265
Further Details:      
 
Domain Number 3 Region: 392-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-31
Family ATP sulfurylase C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320352497|ref|YP_004193836.1|
Sequence length 569
Comment sulfate adenylyltransferase [Desulfobulbus propionicus DSM 2032]
Sequence
MSTLSSIDYSESLIVHFRRAELLRDEAVGLVSLDLNSRQLCDLELLLHRGFYPLSGYLNQ
DDYLQVLETMRLADGTVWPMPICLDVNVDVAASLQPGQRVALNDQEGFLLAILTVGEVWH
PDREHEAEAVYGTTNPDLHPGVKNLYQKTAEWYVGGQVEGVSLPIHYDFRNLRLTPAETH
RRFTQYGWRRVLGFHTREYLHCAHREMVLAAAREINASIFIHPAAGLDHPGNRDHYTLVQ
CYQEFITHFPANMILLGIVSLADRFAGPREALWHAMIRKNFGCSHFMVAKDHGDPFAGSD
QPLFYPQGAAQQLVARMAGETGIAMVPERAMGYVEEKAQYVFLENVGEHESVKTITSQEL
KRRLEWGLEIPEWYSYQNVIQALRRAFPPRSRQGFTVFLTGLSGSGKSTIAKVLMVRFME
MGNRPVTLLDGDIVRKNLSSELNFSEAHRNLNVTRIGFVASEITKNGGIALCAPIAPYEA
SRAANRELISRYGGYIEVYVSTPLEVCEQRDRKGLYAKARKGLVKGVTGISDPYVPPVNP
ELTIDTSTMTPAEAVQEILLYLEEQGYIS
Download sequence
Identical sequences E8RJQ6
WP_015723092.1.51671 gi|320352497|ref|YP_004193836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]