SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|59337|fgenesh1_pm.18_#_186 from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|59337|fgenesh1_pm.18_#_186
Domain Number 1 Region: 11-374
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.98e-98
Family IF2B-like 0.000000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|59337|fgenesh1_pm.18_#_186
Sequence length 391
Sequence
MSLPANALVGLRTEGDKIEIIDQLLLPHVKKYIPIESTDDAYDAIKSMKIRGAPAIASLA
SLSLASHLSQSLAGSSTPSFLSSPTALREHVRPILSHLYSSRPTAVNLGGAIRRLTVILD
GPTAGEDEAATRELAKKLVAEGRLIADEDLGRNFEMAAHGAEWVLKQPKADGREKVNVLT
VCNTGSLATSGYGTALGLITKLHQLGKLERAYYTQSAPYHQGSRLTALELQSLQIPSTMI
CDTMVGSLFQHYDIHAVVVGADRIAENGDTANKIGTYNAAVLAARHGIPFVVVAPVSTVD
LDTPDGAHIPIEHRPPIEACLVRGALYPLPVSEETPQQALVQFTPSGLDGIYNPSFDVTP
AELISAIVTEKGVAVKVQGQNVFSLRSSHVV
Download sequence
Identical sequences jgi|Sphst1|59337|fgenesh1_pm.18_#_186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]