SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330823803|ref|YP_004387106.1| from Alicycliphilus denitrificans K601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330823803|ref|YP_004387106.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 7.45e-51
Family Molybdopterin synthase subunit MoaE 0.00000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330823803|ref|YP_004387106.1|
Sequence length 158
Comment molybdopterin biosynthesis protein MoaE [Alicycliphilus denitrificans K601]
Sequence
MTRVSIQTQDFDVSAELAALRARDARVGAVCCFVGTVRDRNDGDAVATMELEHYPGMTEQ
SIEAMIDEAFARFDLYGVRVIHRVGLLAPLDQIVLVAVTSAHRGESFQACEFLMDYLKTQ
APFWKKEATPQGARWVDARVSDDAALARWGIAAPPQAG
Download sequence
Identical sequences E8TZG2 F4GC16
gi|319763933|ref|YP_004127870.1| gi|330823803|ref|YP_004387106.1| WP_013520064.1.1403 WP_013520064.1.61486 WP_013520064.1.73355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]