SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330823077|ref|YP_004386380.1| from Alicycliphilus denitrificans K601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330823077|ref|YP_004386380.1|
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily SIS domain 1.25e-37
Family mono-SIS domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330823077|ref|YP_004386380.1|
Sequence length 200
Comment sugar isomerase (SIS) [Alicycliphilus denitrificans K601]
Sequence
MLEQRIQQHFIDGADLKYQAAQALSQPIGAAVQAVLACVTNGAKVLACGSGPSAAQAQQF
AAFCVMGFERERPELAALALVSDAVWAAASAAGAGADIAALARQVRALGQAGDLLLAITT
GGSEPALLEAVQAAHERDMTVVALCGRDGGALATLLRETDVQICVPHDRAARVREVHALV
LHCLCDGVDAQLLGEQEILS
Download sequence
Identical sequences A0A0E9L7A2 E8TWC1 F4G3N6
WP_013517387.1.1403 WP_013517387.1.61486 WP_013517387.1.73355 gi|330823077|ref|YP_004386380.1| gi|319761210|ref|YP_004125147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]