SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338732630|ref|YP_004671103.1| from Simkania negevensis Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338732630|ref|YP_004671103.1|
Domain Number 1 Region: 16-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.07e-52
Family PP-loop ATPase 0.00045
Further Details:      
 
Weak hits

Sequence:  gi|338732630|ref|YP_004671103.1|
Domain Number - Region: 364-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00199
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338732630|ref|YP_004671103.1|
Sequence length 406
Comment tRNA(Ile)-lysidine synthase [Simkania negevensis Z]
Sequence
MEKPIKCVRDFLTLNLIPGKRLLLALSGGGDSLALLYLLIECQEKLDFELHIAHVDHAWR
EESEREAALLDRLAKHLKLPFHQKRLSPMIGSNLEDRYREKRYAYFQELQEKWGFQAVLL
GHHADDQGETVLKRICEGARLGGLGGLKAKTERGNLTLWRPLLPMRKAELLIYLNRKKLE
PFDDWTNFDLRYLRPRMRQKIFPELEKQFGKGIGRNFHRLGLLFQEISQYLDEKKEAIMQ
KLVQGPYGAYLEHPSKYPVLEMRYFLEEMARASHAHLSQDSCEILLRLIAINAPKAEVQA
GPLTYILNKDYLFLLKNEIPPFDRSLWKEKGEPSNWKDFWKGSCLTTPSHCQMKLLDELT
PILRKKMKKWYAKHQVPPFLHDKAPIFVIGSKIVGECLTGRSVSIT
Download sequence
Identical sequences F8L794
gi|338732630|ref|YP_004671103.1| WP_013943079.1.32353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]