SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338732941|ref|YP_004671414.1| from Simkania negevensis Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338732941|ref|YP_004671414.1|
Domain Number 1 Region: 26-113
Classification Level Classification E-value
Superfamily SH2 domain 0.000000299
Family SH2 domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338732941|ref|YP_004671414.1|
Sequence length 121
Comment hypothetical protein SNE_A10460 [Simkania negevensis Z]
Sequence
MLTFSRTRLRFKTPFVSKKQQLIVAIKNHASWRGNVSLCEAAALLKGNDPYTFIVSEGMD
ECHFFLSYVSSDRTIKHKNVRVLIDRGDWVVKNGQGLSFPTLDLLVPSCLQCSASVCKPL
V
Download sequence
Identical sequences F8L821
WP_013943390.1.32353 gi|338732941|ref|YP_004671414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]