SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310825999|ref|YP_003958356.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310825999|ref|YP_003958356.1|
Domain Number 1 Region: 7-295
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.57e-63
Family Methylenetetrahydrofolate reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310825999|ref|YP_003958356.1|
Sequence length 296
Comment putative methylenetetrahydrofolate reductase [Eubacterium limosum KIST612]
Sequence
MVNKMSSLLQQTLEAGKFAITAEMAPPKGTDFSHILEIADLLKGRVQGVNVTDYQSAAVK
ASSLAMCVELEKKGLESILQMTGRDRNRIAIQGEMLSAGHFGVKNMLALTGDHTTTGDNP
EAKPVFEMDSVSILQTAEVLMSGQDLAGNELKGAPDFYLGACVTPVFDPIEVQLIKMRNK
IKAGAKFFQTQGVFDIEVMREFKELTKDMDCYVLAGIIPLKSAGMAKFMNRSVPGISVPD
ALIERLTEAEDKAAEGIRIAGEFVAQLKEEGVCDGAHIMAIGAEENVPKILDVAGL
Download sequence
Identical sequences A0A1E7RXB6 A0A1M7F7F8 E3GIA8
WP_013378715.1.44369 WP_013378715.1.80573 WP_013378715.1.85847 WP_013378715.1.86501 gi|310825999|ref|YP_003958356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]