SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310827959|ref|YP_003960316.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310827959|ref|YP_003960316.1|
Domain Number 1 Region: 8-284
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-79
Family Methylenetetrahydrofolate reductase 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310827959|ref|YP_003960316.1|
Sequence length 285
Comment Methylenetetrahydrofolate reductase (NAD(P)H) [Eubacterium limosum KIST612]
Sequence
MTIPEIMKNRMCFSFEVFPPKEGQPLEPLLDTLDHLYAFKPDFISCTYGAGGTNAGRNVE
ICKAIKDSGATIPITHFTCIGNSKDKIRDELRNYLSLGVDHILALRGDFPKGSASTGGDF
NYANELIAFIKEAFPEFSIAMAGDPEKHFEASSFDEDIAHLRIKQDAGADFIMTQLCHDV
AHYEWWVEKIRKAHITLPVDVGIMPVLAKDPTIRMAVSNGSSIPRDLAEIIARYGDNPED
FKKAGMEYTVKQIHRFISAGIDGLHIYSLNKWADISEIVRAAGIR
Download sequence
Identical sequences A0A1E7RUM3 A0A1M7CCS9 E3GDX1
WP_013380674.1.44369 WP_013380674.1.80573 WP_013380674.1.85847 WP_013380674.1.86501 gi|310827959|ref|YP_003960316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]