SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310828454|ref|YP_003960811.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310828454|ref|YP_003960811.1|
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily GlpP-like 6.15e-40
Family GlpP-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310828454|ref|YP_003960811.1|
Sequence length 184
Comment glycerol-3-phosphate responsive antiterminator [Eubacterium limosum KIST612]
Sequence
MSKIDFGKFQMIPSIRRLNDLEVALKSSREIVLLTEANIANLQSLVEMVHRSGKDAWVNL
ELLGGFGRDQVGMKLLKNYYRVDGVMSTDSTKLGMAKRCGLVTVQRFFIVDSRGFDTSLR
ILESAKVDAAEVLPAVAALGFIDELKRVSRIPLLAGGFIQTAEMIEKVQHAGFAGITISK
KAFW
Download sequence
Identical sequences A0A1E7S254 A0A1M7GSE6 A0A1V0LZ08 E3GNH1
WP_013381168.1.33738 WP_013381168.1.44369 WP_013381168.1.80573 WP_013381168.1.85847 WP_013381168.1.86501 gi|310828454|ref|YP_003960811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]