SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310830117|ref|YP_003962474.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310830117|ref|YP_003962474.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.96e-24
Family Ribosomal protein L9 C-domain 0.00032
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.62e-16
Family Ribosomal protein L9 N-domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310830117|ref|YP_003962474.1|
Sequence length 149
Comment 50S ribosomal protein L9 [Eubacterium limosum KIST612]
Sequence
MKVVLLEDVQNVGKAGEIVNVKDGYGRNFLIKTNKGLPGTKENIAKAEEAQALKKQQMEE
ERQAAVALAKVIDDTTITIAEKAGEDGKLFGSVTSKDIAEALEAQKEIKVDKRKIALNAP
VRNVGRIEVKVKTYAGVEGNLTVVVEAAK
Download sequence
Identical sequences A0A1E7RYH8 A0A1M7D6T2 E3GR69
WP_013382816.1.44369 WP_013382816.1.80573 WP_013382816.1.85847 WP_013382816.1.86501 gi|310830117|ref|YP_003962474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]