SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328953629|ref|YP_004370963.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328953629|ref|YP_004370963.1|
Domain Number 1 Region: 788-910
Classification Level Classification E-value
Superfamily CheY-like 2.13e-31
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 241-423
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-23
Family GAF domain 0.0069
Further Details:      
 
Domain Number 3 Region: 407-524
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000332
Family N-terminal PAS domain of Pas kinase 0.095
Further Details:      
 
Domain Number 4 Region: 603-770
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000038
Family Histidine kinase 0.011
Further Details:      
 
Weak hits

Sequence:  gi|328953629|ref|YP_004370963.1|
Domain Number - Region: 142-187
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000366
Family MJ1460-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328953629|ref|YP_004370963.1|
Sequence length 937
Comment PAS/PAC sensor protein [Desulfobacca acetoxidans DSM 11109]
Sequence
MEKHHGCLNTKVIIDYFQEHFPALTPTLLQDLHPEIEVLPNPQEFLTDINNWVSSDVVIQ
MFKKARSLSQDDEIAFKIGSYAATKQKFGYVQRIITQAFGNPRLALKKIQVISDKFNRNK
TVEVQFIGRCQAVVKFRYFRHIPADEDFCLFNRGILTAMPTIWHLPPGDLEERRCYFHGD
DYCEYFCTWEDRSRLKKWLRSVFLPWRLLRDTIQELEKDKEILKRKYDEVHHLNLQLKEK
IDQLMSLPETCMAALTAVDLKGLLQVTLNFLIRFAKLDRAGVFLLNEASNHLEIHCGVGI
DPTLYEKVKDYKIPVSKVDNVIARVAINGIPVVINDVAHSRLNKGNQLIQLFQPKAFILA
PISVRGKVIGVILADRMRCDPHIADIDKELVMNFAHQIAMALDSALMHRRLEISERRYRE
LVENAYEGIWIIDGQGIIRFANRRLREIIDEEHLEGKELSLFLRGDNSKFLATMLVQNRK
GKVAQQELELQTPKGKTISVILSSVPLMEEEQYVGSFAMINDVTSMRKMERQLLQQQKME
AIGALASGWARNFNDILINILILNGLVLADLKPTGPGYNDLKQIEQEVTKGAELIDQLLS
FGQRHFSLKPVDLNLLIDKIIKLLRFSHKQMRIHYRPGPQVPAAEVDQGQIEQVLVNVLL
MGRPRGAKVQEVAISTEEVVLDEEFCQPYNRLPGPYVYIAFNFPQLVVNAELQGKIFEPF
VVSEEVGSEGRPSLASVYSIIKNHQGIIEMDSEAAFGTTFHIYLPVSKKPVQTYQPRPLR
FVRGSGVILLVDDEEPVRAIGARILGRLGYKVIPAATGMQAIAIVQERREEIDLVVLDMV
MPGLSGRETFYRLREIDPEIKVLLYSAHSMDEDVHLMMEKGALGFIQKPYRIAALSQKIA
AMLGGGKTVKPEVIDAEDAGTQPENALRDEWSAVSGQ
Download sequence
Identical sequences F2ND58
WP_013706891.1.50338 gi|328953629|ref|YP_004370963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]