SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328952961|ref|YP_004370295.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328952961|ref|YP_004370295.1|
Domain Number 1 Region: 391-564
Classification Level Classification E-value
Superfamily TPR-like 4.64e-29
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328952961|ref|YP_004370295.1|
Sequence length 573
Comment YcaO-domain-containing protein [Desulfobacca acetoxidans DSM 11109]
Sequence
MTETFLLQDCYKQYSYDLDKVCPPEETVARVKYRFKQLNLDLLKNTLRIDSGRLGIPVYV
SLCGVDAVRTIGTQKQMGKGSTPEQAEASALMELVERFSFFSFMHQADFLYATPNSLGPE
SVSFKTLARSLFDVSEEAEQVKAIYRDWPLHFTSAVSLTYGHPVLLPIHWFYLINEYNGP
AAGNTLEEAVLQGLCEVVERHVGSVISHGRLFTPVIDPASVQDPAAVELLEKFRRQGIVI
HLRDFSLDTGIPTVGVLAYDPATFPEASEIIFTAGTTPDPEKSLVRALTEVAQLAGDFNK
RTSYRPTLPKYENLTEASYLTAPGPMRPIRSLPQLADDNIKVEIERCVATLTRLGLEVLV
VDVTHPQIRIPVVYVIAPGAHFLERTRQTNVIFHLAKLASRYAEPEDAMQALTRLHERFP
GRFDVLFFLGLTMDTLGRTAEALSYFAASLQAYPPAHEIASIYVHIGSCRKDLGDYSGAV
TALKQAQAANDQLKEVYHLLGFCYFKLKEHQRAVECFEKAIELDPGSGIDYANLGINLRE
LGFRQEAAHLLQMALDLDPSLDFARLALEKLAE
Download sequence
Identical sequences F2NCI0
gi|328952961|ref|YP_004370295.1| WP_013706226.1.50338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]