SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328953109|ref|YP_004370443.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328953109|ref|YP_004370443.1|
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.31e-119
Family UbiD middle domain-like 0.0000000479
Further Details:      
 
Domain Number 2 Region: 320-483
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 3.79e-61
Family UbiD C-terminal domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328953109|ref|YP_004370443.1|
Sequence length 489
Comment menaquinone biosynthesis decarboxylase, SCO4490 family [Desulfobacca acetoxidans DSM 11109]
Sequence
MGYDSLQKFIKVLEKQGELRRITQPFSPHLEITEVTDRVCKLKDGGPALLFENVPGYDMP
VLMNAFGSMKRMCLSLEVNDLEEIAADILSFLEAEAPNTLMKKLKMIPKLRRLANIFPKT
VGRAPCQEVVLQGDEVDLTKIPVLTCWPLDGGPFITLPVVITHHPVTGKRNVGMYRLQVY
DKNTTGMHWHKHKGGAAHYRAAEHRRERLPAAVAIGPDPAVTYAATAPLPDDLDEMIFAG
FLRQEPVELVQCVDVPLYVPAASQIVLEGYIEPGERRREGPFGDHTGYYSLADEYPVFHV
TALTRRREPVYPATIVGKPPMEDCYLAKATERLFLPLIKKTLPEIVDMNLPMEGVFHNLA
FISIDKRYPGHARKVMHALWGLGQMMFCKMIVIYDREVDVQDLGAVLWRLGNNVDPRRDV
VFVDGPVDALDHASPLPHYGSKMGIDATRKWPEEGFTREWPAVIEMDSGVREKVDRIWDR
LGLNNDRSR
Download sequence
Identical sequences F2NJ90
WP_013706374.1.50338 gi|328953109|ref|YP_004370443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]