SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328953787|ref|YP_004371121.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328953787|ref|YP_004371121.1|
Domain Number 1 Region: 206-361,394-757
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 6.51e-119
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.000000243
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.24e-35
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 753-872
Classification Level Classification E-value
Superfamily ADC-like 2.12e-19
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0094
Further Details:      
 
Domain Number 4 Region: 134-202
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000251
Family Ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328953787|ref|YP_004371121.1|
Sequence length 882
Comment NADH dehydrogenase (quinone) [Desulfobacca acetoxidans DSM 11109]
Sequence
MINLTIDGKAIQVEEGKTILQAAQANGIRIPFLCYHPAIKAIGSCRICVVEVKPGPPRPQ
PACTTRVSEGMEVITNSERIKSIRRELVKFMLVNHPLDCPWCDKGGECELQNLTHELGIA
EVDYEAARKPINNDVESPLIERYNTRCVTCGRCVRVCRERVGASAINFENRGYFTDLGSG
QQPLNCEFCGTCIEVCPVGALINKLFKYSARSWEMTQSETICQFCGGGCNYQVNVKDGKV
LRVSREAENPLLCMRGRFGFGVLNSPERIKTPLIKKGGQFVEATWDEALEFAAQGLMQVM
AKSGSGAVYGIGSPRASNEANYLLQKLFRVGLGSNQIDNPARYNYLRALEGIAEVFGKPE
IEGINPERQKISKPFHSPLMLEEGAKGKGFPFVLGDCEKLSQADVVLVLGADVTPEMPPY
GWQLMKALQNENFRLIVANPRKTKYDRYAHLKMRYKPGSERALLVGLMEAVLEGKPGHEP
YLAAEGFEVFKENLLKAPLQDIKSRTGVLVGDLREAGKLLAQAQAPAIIFGNDVLAQVQG
KENAVAIANLFLLIGQPCNPGSGLYPIAEKNNTHGVCDVGVLPNLLPGYQELGGGTAFTD
IWGKAPSTLAGMPLDEALSKLENNAVNAPQAFYIMGGDMVRQLPNSTRVLGILQKAKFIV
MQGAFMTETAKVADVVLPVAIHAEVNGTYTNTDGKLGRLQAAVGTNGVRPGWQIIADLSR
KLDVPMEYANEEDIFREMSAGMPLYAGIQPGYRWPCPSITAEVKGTFVPFSPEVDISGEG
PFTLIVGKTMGHSGSFTTWAAGPMTILSGQVLKMNPDDAAALGIAAAEKVTVSSNQGSIA
VTVALTEEMPAGVVFLADHFADPMANTLTLNSNLCRVTIQKG
Download sequence
Identical sequences F2NJZ6
gi|328953787|ref|YP_004371121.1| WP_013707049.1.50338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]