SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328953891|ref|YP_004371225.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328953891|ref|YP_004371225.1|
Domain Number 1 Region: 189-297
Classification Level Classification E-value
Superfamily TPR-like 0.000000000136
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  gi|328953891|ref|YP_004371225.1|
Domain Number - Region: 78-138
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328953891|ref|YP_004371225.1|
Sequence length 315
Comment hypothetical protein Desac_2216 [Desulfobacca acetoxidans DSM 11109]
Sequence
MLQIYSFEACWRLLGLLLVSGMVCTGCADVPFLKKAPLQESMAESSYEPPPQPLPDPEPK
AQPIIRPTSNPGSSNPIDARLAELASQFEVIRTRVQVLEGKLAEQEHQLSQLIKSGNPQQ
AQMQEKLSGLERELAATQERLAQVEGQRPPQAVAAVPVAMSGNREAGEAAPTAKKAPPAA
PAKVGSDPFAEGLTLYKQKSYGPAREKFQRYLEEHPKGEKAIEARYYLADSLYQEKHHDE
AIVEFNKLLEGYPKSTLAPASLLKQAYAFKAQGKSKVHNLILEKLIADYPQSPEAVQARK
LRGSGAAVSDKKKGK
Download sequence
Identical sequences F2NFC5
gi|328953891|ref|YP_004371225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]