SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114360|estExt_Genewise1Plus.C_170155 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114360|estExt_Genewise1Plus.C_170155
Domain Number 1 Region: 120-295
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4.32e-46
Family NadC C-terminal domain-like 0.000041
Further Details:      
 
Domain Number 2 Region: 10-119
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 9.03e-25
Family NadC N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114360|estExt_Genewise1Plus.C_170155
Sequence length 298
Sequence
MATASSASHSYEHLLPPSWKPQVTAWLQEDTPSFDYGGYVVGEEPREAFLLGKGKQTAVL
AGAPFFTEVFAQLGCEVEWHLEEGVTFEPVRHVATVRGKARHILLGERVALNMLARCSGI
ATKSKRILDQARGYGYEGVIAGTRKTTPGFRLVEKYGMLVGGIDPHRHDLSSMIMLKDNH
IWSSGSITAAVQAARKVGGFSLLLEVEVGSEAEADEAIAAGADIIMLDNIEGAELVGVAR
TLKAKWSGQRKFLFESSGNITEANLQERAINEIDILSTSSVHQSVQHIDFSLKIQKPN
Download sequence
Identical sequences A0A1X6MUP7
jgi|Pospl1|114360|estExt_Genewise1Plus.C_170155 104341.JGI114360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]