SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128233|estExt_fgenesh3_pg.C_1670014 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128233|estExt_fgenesh3_pg.C_1670014
Domain Number 1 Region: 231-487,522-573
Classification Level Classification E-value
Superfamily SPOC domain-like 6.08e-55
Family Ku70 subunit middle domain 0.00019
Further Details:      
 
Domain Number 2 Region: 1172-1381
Classification Level Classification E-value
Superfamily ITPase-like 5.04e-35
Family Maf-like 0.00022
Further Details:      
 
Domain Number 3 Region: 836-934
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.76e-31
Family Thioltransferase 0.00029
Further Details:      
 
Domain Number 4 Region: 10-195
Classification Level Classification E-value
Superfamily vWA-like 3.02e-26
Family Ku70 subunit N-terminal domain 0.0039
Further Details:      
 
Domain Number 5 Region: 697-807
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-20
Family Thioltransferase 0.0043
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|128233|estExt_fgenesh3_pg.C_1670014
Domain Number - Region: 675-685
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000233
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128233|estExt_fgenesh3_pg.C_1670014
Sequence length 1394
Sequence
MLELREDPRYEDVQTCHLFTALEAAIHIQKKKVIVGPNDSVGIMLFNTTRRNEAGGQGAD
IKKGNYVYQPIDTINAPTIQELMRLIDAAREDPHVLLETFPSLTESRVPTGDVFTSCNWV
MRDGAPKTATKRVFLITDEDNPHAGPGKERFITTARTTLMDLVQAGIGVEPFFISTDEKP
FDPTKFYSSVLLPTNITDDDGAEGTILPESISITRVDELLAQMSFHEVPKRALFSVPFEF
AKGFTIGVKGYGLVTEQKKGSYKYFVDFGDRMEVAVTRTTYVDEEKETEADKERLLYGME
LGSTAATEEHAHESADEGGGPARTVPVNSRVFYTLGEVRSFRTMGLKPTIKLLGFKDRSE
LAFEDNVKHSLFIYPDEMSYSGSKRTFTALLRTMLRKKKIGLVLSVVRRNASPIFCALLP
QKEKTEESGWHEPPGFHLIPLPFADDIRAAPIEETVRASDELKDAARKWVDKLTVKNGAY
APDAFPNPGEICHWPRCDGPTLSSMPFSHRFHPLGPAGRRPAALSYHNAQLEASAFREEF
DPTSFEDPTEPKYDRMHQRAGALMRSWKEALLQDEAAHTSIVTAGSKRKALRVDQLKVRL
SQEQELVGVREESRAGGEGWRMARQPPIGLGAKPRWIFARRLLGNGGISRNEPRGLVIPE
TIVAERPPPALPSTPPPPPPPPPPPAQRTPEATMTVAAPENVREVTSPEHFQELLSADLE
RVSLINFWAPWAEPCKQMNDVVLELGRKYPQLLVLQVEAETQSDISESFEIESVPAFIIL
RGHTLLGRISGADAPALTDAVAKHTKPPAAVKPLAKTDRAPAAAEALSEKEETQEELNER
LRALMNKDKVVLFMKGEPDAPRCGFSRRIVGLLQDQGVPFAHFDILSDEKVRAGMKTLNN
WPTFPQLIVNGEFVGGLDIVQEMVENGELKEMVAATCLVHSSAVSTGWRCPGLDLTFKFA
AALAGTAFGARGPFRLFTDAVLLRRRMIHAGPNEPLLGASRYLNYQTGRGGIKVVDEGAR
TQGGSGRSSFPNAPAAQGHKYAAPQLPRPRDRRRISNACSHVRAQPDTGGQAIWRDQSGH
VRERGTDAAACYGQPRHPLRAPPAHPYPYMAKGNSTSGAAQSMAGLYLCRRIKAASAMFK
FLSEKQISLPEHNCVLPHALRVPSLQKLVGKRVVLASNSPRRKEILQIFGLAPEIVPSTF
NEDLSVGSFEDIHEYPVATASHKAVEVYERLVRTNPEDAPDLVIGADTVVLTHPSPGLAS
TSPSDVPLEAQDLMEKPIGKNDMRMLLDLNGGVCEVVTGVTVVYPVLEAPGYKLKSIEER
TLVYFAENPRELLEAYVESGEGLDRAGGFAVQGLGGMLVRKVDGDYQNVVGFPAASFFKF
LDMLLEEESDFLAV
Download sequence
Identical sequences 104341.JGI128233 jgi|Pospl1|128233|estExt_fgenesh3_pg.C_1670014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]