SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|96782|fgenesh3_pg.46__47 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|96782|fgenesh3_pg.46__47
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily ITPase-like 4.19e-61
Family ITPase (Ham1) 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|96782|fgenesh3_pg.46__47
Sequence length 188
Sequence
MSGSKSIFVTGNANKLKEVRAILAKSGVEIDSQELDIPEIQGSTQEVALAKCHRAAELLG
GPCITEDTALCFEALNGLPGPYIKYFLKELGHVGLNTLLDGFPTRAAWALCTFAYSAGPG
TEPVLFEGRTDGQIVSARGEGKFGWDPVFEPSGTGKTYAEMSAEQKNTLSHRYKALEKLQ
TYLSTMNV
Download sequence
Identical sequences A0A1X6MTK1 B8P8E5
104341.JGI96782 XP_002471958.1.31404 jgi|Pospl1|96782|fgenesh3_pg.46__47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]