SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|100089|fgenesh3_pg.132__34 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|100089|fgenesh3_pg.132__34
Domain Number 1 Region: 16-60
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000798
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|100089|fgenesh3_pg.132__34
Sequence length 266
Sequence
MPRSTTILADWQPNPGWTPKESCRQCGSSRHWVRDCPDVRCAGCGKEAPGHLERECRTRP
MKRHVSAPPEEPARRMGVVVDNVFIKGIINEAKERKEKKRQMKAVPIPPPRSANPEPPAS
PVAGSSRPYPDTPIVFRKVDPDWTPDSTQWTWDSSWPHQKHLSGKEWKNMGRNARKEWFD
EEEDDGVDWELYGNGEHHQCFNPNDLVLLEVNIKHWKINEDGSPAYTPGWARWRTGLEML
VLSKDLPVNDEVFIAIALELDIAAPV
Download sequence
Identical sequences B8PH09
jgi|Pospl1|100089|fgenesh3_pg.132__34 104341.JGI100089 XP_002474968.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]