SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|102249|fgenesh3_pg.194__2 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|102249|fgenesh3_pg.194__2
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000244
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|102249|fgenesh3_pg.194__2
Sequence length 385
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQRDDHVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPTDWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQTKAIPIPPPRSANPEPPTSPVAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYG
DGEHLHNGVHAHFVPGIVPLRFFLH
Download sequence
Identical sequences B8PKG6
jgi|Pospl1|102249|fgenesh3_pg.194__2 104341.JGI102249 XP_002476170.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]