SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|106043|fgenesh3_pg.220__10 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|106043|fgenesh3_pg.220__10
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|106043|fgenesh3_pg.220__10
Sequence length 279
Sequence
MTRLELKWQVTTGSIIGSNLAATSSATAFVTKSHGNSSKPRKTCSNCNMTGHEIADCFQL
GGAMEGKCAEVLTTKCPCLDKGKSGGSKVLHDPDGRMFMLSNTGDTMYIDTTASMASSSA
AKAPSTKFASLTVDTPDPVDLWAFPTLSPADTFKYSTLTRSLTDEDTASVDWGHHSSTAS
VTALATAAPAAAAALGTAPFFFDFSASTHLSPCKDNFSDLVAIAPHGIRGINGSVIYMHG
VSTIVLAIPIIALSLTWLRPTFYQGVNELCNSWDWCMWT
Download sequence
Identical sequences A0A1X6MJ47 B8PLE2
XP_002476493.1.31404 jgi|Pospl1|106043|fgenesh3_pg.220__10 104341.JGI106043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]