SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|47425|e_gw1.3.15.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|47425|e_gw1.3.15.1
Domain Number 1 Region: 239-300,332-584
Classification Level Classification E-value
Superfamily SPOC domain-like 8.24e-50
Family Ku80 subunit middle domain 0.00023
Further Details:      
 
Domain Number 2 Region: 11-221
Classification Level Classification E-value
Superfamily vWA-like 1.35e-31
Family Ku80 subunit N-terminal domain 0.0093
Further Details:      
 
Domain Number 3 Region: 671-809
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 2.09e-23
Family C-terminal domain of Ku80 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|47425|e_gw1.3.15.1
Sequence length 816
Sequence
MPAERAGYTVTMFLVDISPSMGKLREIEVPSGKDGELDTIEITNLELALQFVMLKIQEMI
YNGRKTDQCGVITFGSEETDNIIHEKHGGYENVSEYIPIGQPNAGTLAKLARLQPSKVIG
DPIDALIVGIETQHQYLSSKKTWTRKMVLLTDGENPIEVEDWEATVHKMNTVQTHLTVVG
VDFDDEYFPFLEEGKSNIKRANEEFYHTLAKSMAHGIVGNCDFALQELSRPDIKQTKSAL
LGTVLRIGDVDARPEEAIEILVKTSKATAISRPKSWKKFARRQKEESEEEANIPLDEETE
VYAQLHMRTQYMIEKQPPEGEEDQPPVYEQLEGITKEELVRGFKYGSSYAPCPGGQFERL
PTRRGIDICGFFLEKNFRREWEMSEVTYVWADPAQPLQQVALSAVVQAMYEKGAMAIARW
ASRDGMDPKMGVLRPTMFEKADCFMWVQMPFADDVRNFSFASLETLINKKGEVITDHPYL
PTDEQMEAMEQFVDAMDLMDAGEKDEEGNREPWFDTRLSYNPVIHRTKQAQFHAAIVADL
NTHPLPPAHSELTKYFEPPKRVLKRSRDAIEECKQVFKVKEVPKRVARTRKDGHVRAGDE
DEDMILLDKMPRRKLSKSASQFVASQQEASTSRSQVPRRKKSNPNDSATESETEDEDEEL
LLDKKQLPTPVPDADEDTDAAPTTRIVGTESPLEDFKNNISRGDLVTKAVEDFGAVIKEI
VLRPFSARRTEEMLQCMQELRKVCLEEDEVDAWNAFLTDLRQACVEKSGNPDFWPRVRDL
GRAISLISSSEASSLGGKSDISETKAAEVRSHAAWF
Download sequence
Identical sequences 104341.JGI47425 jgi|Pospl1|47425|e_gw1.3.15.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]