SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|58033|e_gw1.227.6.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|58033|e_gw1.227.6.1
Domain Number - Region: 180-205
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00113
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|58033|e_gw1.227.6.1
Sequence length 275
Sequence
SLSLLDGDARAWATPYFAQLVSVQIGVQGAVTPFRNEAAFAAAFKARFGNLDDEAAAQVE
LVKLCADKSVREKRTAAEFSALFKGPADRSGYGDLELRDKYLSGIPSCMYQKIELETFTT
WQAAEKRATEVEQILDISRARRPELNNFFSARGRGRGGACGGAPQSHAASASINAAVGKG
NFPGTCFGCGKQGYRHFECPNCKDKPYTKRADARATVASGSTQAATSAPVTTTPSASISA
ASAKSEQSELADLMAQVKSMREELEHYRAMKEEGF
Download sequence
Identical sequences 104341.JGI58033 jgi|Pospl1|58033|e_gw1.227.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]