SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|63521|e_gw1.219.1.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|63521|e_gw1.219.1.1
Domain Number 1 Region: 33-382
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.11e-60
Family TK-like PP module 0.061
Further Details:      
 
Domain Number 2 Region: 397-606
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.3e-20
Family TK-like Pyr module 0.052
Further Details:      
 
Domain Number 3 Region: 614-754
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000116
Family Transketolase C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|63521|e_gw1.219.1.1
Sequence length 807
Sequence
MPGQLISQPNPPPDPSLLPDSLLEYRVQLDTNGILSPDDLEAVIQFKRAANYIAAAMIFL
KENVLLERPITPDDIKPRLLGHWGTCPGLVLVYAHMNRIIRNTNIDALYVVGPGHGAPGI
LSCLWLEESLATFWPRNTRDKKGLHNLISGFSAPGGFPSHINAETPGSIHEGGELGYALA
VSFGAVMDNPDLICICVVGDGEAESGPTAAAWHGYKYIDPAESGAILPIVHVNGFKISER
TIYGTMDDKELVALFAGYGYQVRFVEDLPHIDEDMAASLQWALGEIHKIQDAARNGRPIV
KPRWPVLILRTPKGWSGPKEIHGEFIEGSFHAHQVPLPKAKTDKEELQALQAWLESYKPK
ELFDAEGRPNKKILSIIPERQEKKLGQRKEAYAAYTPLDVPAWKPFGVEKGTEASCMKTI
GEFLYQVIEQNAHTFRIFSPDELVSNKLDAVLRHSGRNMQWDVASRANGGRVIEILSEHT
CQGMLQGYTLTGRTGLFPSYEAFLGIIHTMMVQYSKFVKMARETPWRQPVGSLNYIETST
WARQEHNGFSHQNPSFIGAVLNLKPTIARVYLPPDANCFLSTVAHCLRAKNYVNLMVGSK
QPTPVWLSPDEADRHCIAGASVWKFASVDDGTDPDVVLVGIGVEVTFEVIAAAAMLRRRL
PAMRVRVVNVTDLMILEPYGAHPHALSQANFVGLFTNDRPIHFNYHGYPGELKSLLFGRP
NLDRVTIEGYGEEGTTTSPFSMMLLNHTSRYHVAVHAVKGAALRNPRVAIDLHEVVSEML
HQAEKDKEYVLRHGADREGTFDVPTFE
Download sequence
Identical sequences jgi|Pospl1|63521|e_gw1.219.1.1 104341.JGI63521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]